What is codfish allergy

TY — JOUR

T1 — Severe reaction in a kid with asymptomatic codfish allergy

T2 — Food challenge reactivating recurrent pancreatitis

AU — Pellegrino, Katia

AU — Durbano, Leila Emma

AU — Artesani, Maria Cristina

AU — Riccardi, Carla

AU — Mancini, Sandro

AU — Bella, Sergio

AU — Alghisi, Federico

AU — Cavagni, Giovanni

PY — 2012

Y1 — 2012

N2 — An 8-year-old kid during the first year of life manifested severe atopic dermatitis and chronic diarrhea with mucorrhea and rectal bleeding; a fish-free diet was started based on weakly positive skin-prick tests to codfish extract.

At the age of 4 years the kid began to suffer of recurrent pancreatitis. When he came to our attention for the evaluation of his fish allergy, he was asymptomatic; a feeble reactivity to codfish was observed (SPTs: cod, 4 mm, sIgE ImmunoCAP: cod, 1.30kU/l). The food challenge test with cod was negative. When the kid ate cod again, within 5 minutes, developed anaphylactic reaction and complained of abdominal pain compatible with pancreatitis (enzyme serum levels risen and parenchymal oedema at ultrasonography), that resolved within 7 days after specific therapy.

This case raises two issues: the elimination diet in asymptomatic food allergy on the basis only of SPT and the ethicality of food challenge in gastrointestinal chronic disease.

AB — An 8-year-old kid during the first year of life manifested severe atopic dermatitis and chronic diarrhea with mucorrhea and rectal bleeding; a fish-free diet was started based on weakly positive skin-prick tests to codfish extract. At the age of 4 years the kid began to suffer of recurrent pancreatitis. When he came to our attention for the evaluation of his fish allergy, he was asymptomatic; a feeble reactivity to codfish was observed (SPTs: cod, 4 mm, sIgE ImmunoCAP: cod, 1.30kU/l).

The food challenge test with cod was negative. When the kid ate cod again, within 5 minutes, developed anaphylactic reaction and complained of abdominal pain compatible with pancreatitis (enzyme serum levels risen and parenchymal oedema at ultrasonography), that resolved within 7 days after specific therapy. This case raises two issues: the elimination diet in asymptomatic food allergy on the basis only of SPT and the ethicality of food challenge in gastrointestinal chronic disease.

KW — Anaphylaxis

KW — Challenge

KW — Codfish

KW — Food allergy

KW — Pancreatitis

UR — http://www.scopus.com/inward/record.url?scp=84863228105&partnerID=8YFLogxK

UR — http://www.scopus.com/inward/citedby.url?scp=84863228105&partnerID=8YFLogxK

U2 — 10.1186/1824-7288-38-16

DO — 10.1186/1824-7288-38-16

M3 — Article

C2 — 22571554

AN — SCOPUS:84863228105

VL — 38

JO — Italian Journal of Pediatrics

JF — Italian Journal of Pediatrics

SN — 1720-8424

IS — 1

M1 — 16

ER —

BIOPEP: Report

ID 17
Name Parvalbumin-beta, Baltic cod (Gadus callarias), Allergen Gad c 1
Sequence
AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG
Number of amino acid residues

113

Chemical mass 12124.4430 Monoisotopic mass 12117.0244


Structure of epitopes sure experimentally or predicted by programs ALGPRED and/or EVALLER
AAEAACFK,EGSFDEDGFYAKVGLDAFSADELK,EGSFDEDGFYAKVGLDAFSADELKK,SFDEDGFY,VGLDAFSADELK,VGLDAFSADELKKLFK,IADEDKEGFIEEDELK,EGFIEEDELKLFLIAFAADLR,LFLIAFAADL,A
GDSDGDGK,AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGL,AACFKEGSFDEDGFYAKVGLDAFSA,KLFLIAFAADLRALTDAETKAFLKAGDS
Location
[13-20],[21-44],[21-45],[23-30],[33-44],[33-48],[49-64],[55-75],[65-74],[88-96],[1-35],[16-40],[64-91]


Additional information:
Protein known as: allergen Gad c 1, allergen Gad c I, allergen M.

Chain: from 1 to 113. In muscle, the calcium-binding protein parvalbumin is thought to be involved in muscle relaxation. This protein binds two calcium ions. Ref.: UniProt database (http://www.expasy.org). Access. No P02622

Location of the experimental epitopes corresponds with the fragments:

AAEAACFK [13-20] (IEDB-AR ID 100)

EGSFDEDGFYAKVGLDAFSADELK [21-44] (IEDB-AR ID 12272)

EGSFDEDGFYAKVGLDAFSADELKK [21-45] (IEDB-AR ID 12273)

SFDEDGFY [23-30] (IEDB-AR ID 57739)

VGLDAFSADELK [33-44]

VGLDAFSADELKKLFK [33-48] (IEDB-AR ID 68707)

IADEDKEGFIEEDELK [49-64]

EGFIEEDELKLFLIAFAADLR [55-75] (IEDB-AR ID 12162)

LFLIAFAADL [65-74]

AGDSDGDGK [88-96]

References for experimental epitopes:

Elsayed, S., Apold, J., Aas, K., Bennich, H., 1976.

The allergenic structure of allergen M from cod I. Tryptic peptides of fragment TM 1. Int. Arch. Allergy Appl. Immunol. 52, 59-63

Elsayed S., Apold J., 1977, Allergenic structure of Allergen M from cod II. Allergenicity of the limited tryptic hydrolysis peptides of fragment TM 2. Int. Arch. Allergy Appl. Immunol., 54, 171-175

Elsayed S., Apold J., 1983, Immunochemical analysis of cod fish allergen M: locations of the immunoglobulin binding sites as demonstrated by the native and synthetic peptides. Allergy, 38, 449–459

Elsayed S., Apold J., Holen E., Vik H., Florvaag E., Dybendal T., 1991, The structural requirements of epitopes with IgE binding capacity demonstrated by three major allergens from fish, egg and tree pollen.

Scand. J. Clin. Lab. Invest., 51, 17-31

Reference for IEDB-AR database:

Zhang Q., Wang P., Kim Y., Haste-Andersen P., Beaver J., Bourne P. E., Bui H.-H., Buus S., Frankild S., Greenbaum J., Lund O., Lundegaard C., Nielsen M., Ponomarenko J., Sette A., Zhu Z., Peters B., 2008, Immune epitope database analysis resource (IEDB-AR). Nucl. Acids Res., 36, W513-W518

Location of the predicted epitopes corresponding with the fragments:

AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGL [1-35]

AACFKEGSFDEDGFYAKVGLDAFSA [16-40]

KLFLIAFAADLRALTDAETKAFLKAGDS [64-91]

was sure by program EVALLER.

No epitopes found by program ALGPRED.

Ref.: ALGPRED: Saha, S.

and Raghava, G.P.S. (2006) AlgPred: prediction of allergenic proteins and mapping of IgE epitopes. Nucl. Acids Res., 34, W202-W209.

EVALLER: Martinez Barrio A., Soeria-Atmadia D., Nistér A., Gustafsson M. G., Hammerling U., Bongcam-Rudloff E., 2007, EVALLER: a web server for in silico assessment of potential protein allergenicity. Nucl. Acids Res., 35, W694-W700.


Homology:
Allergen belongs to EF-hand family (AllFam ID: AF007).

AllFam database: http://www.meduniwien.ac.at/allergens/allfam/

Radauer C., Bublin M., Wagner S., Mari A., Breiteneder H., 2008, Allergens are distributed into few protein families and possess a restricted number of biochemical functions.

J. Allergy Clin. Immunol., 121, 847-852.

The experimentally proven epitope:

AGDSDGDGK [89-97]

occurs in the following allergens:

BIOPEP ID 1: Parvalbumin, mackerel (Trachurus japonicus), Allergen Tra j 1;

BIOPEP ID 16: Parvalbumin-beta 1, Atlantic cod (Gadus morhua), Allergen Gad m 1.0202;

BIOPEP ID 18: Parvalbumin, common carp (Cyprinus carpio), Allergen Cyp c 1.01;

BIOPEP ID 19: Parvalbumin, common carp (Cyprinus carpio), Allergen Cyp c 1.02;

BIOPEP ID 20: Parvalbumin-beta, Alaska pollock (Theragra chalcogramma), Allergen The c 1;

BIOPEP ID 21: Parvalbumin-beta, chub mackerel (Scomber japonicus), Allergen Sco j 1;

BIOPEP ID 90: Parvalbumin, common carp (Cyprinus carpio), Allergen Cyp c 1.03;

BIOPEP ID 91: Parvalbumin, common carp (Cyprinus carpio), Allergen Cyp c 1.04;

BIOPEP ID 92: Parvalbumin-beta, Atlantic cod (Gadus morhua), Allergen Gad m 1.0201;

BIOPEP ID 94: Parvalbumin beta, Edible frog (Rana esculenta), Allergen Ran e 2.0101;

BIOPEP ID: 96 Parvalbumin beta, Bull frog (Rana catesbeiana), Allergen Ran c parvalbumin


Bibliographic data:
Authors
Elsayed S., Bennich H.
Title
The primary structure of allergen M from cod.

Scand.

What is codfish allergy

J. Immunol. 4, 203-208

Year Editor
1975 Journal


Database reference:
UniProt database (http://www.expasy.org) protein entry name/accesion number: PRVB_GADCA/P02622. NCBI Taxonomic Identifier: 8053.

Allergen Atlas database (http://tiger.dbs.nus.edu.sg/ATLAS/), Allergen Gad c 1

Allergome database (http://www.allergome.org/); Allergen Gad c 1, code 357; Allergen Gad c 1.0101, code 3290

WHO-IUIS database (http://www.allergen.org/), Allergen Gad c 1


Biomarkers:
Markers selected in silico:

— MARKER OF PRECURSOR, FISH AND AMPHIBIAN PARVALBUMINS

AGDSDGDGK (precursor fragment 89-97);

Sequence cross-coverage with epitope 100%;

Fragment may be released by trypsin EC 3.4.21.4, thermolysin EC 3.4.24.27 or oligopeptidase B EC 3.4.21.83;

Trypsin may liberate fragment from 70 and thermolysin – from 118 parvalbumin sequences;

Peptide may serve also as a marker for the following allergens present in BIOPEP database:
BIOPEP ID 1: Tra j 1;
BIOPEP ID 16: Gad m 1.0202;
BIOPEP ID 18: Cyp c 1.01;
BIOPEP ID 19: Cyp c 1.02;
BIOPEP ID 20: The c 1;
BIOPEP ID 21: Sco j 1;
BIOPEP ID 90: Cyp c 1.03;
BIOPEP ID 91: Cyp c 1.04;
BIOPEP ID 92: Gad m 1.0201;
BIOPEP ID 94: Ran e 2.0101;
BIOPEP ID 96: Ran c parvalbumin;
Potential marker of parvalbumins as well as fish and amphibian proteins

— MARKER OF PRECURSOR

AGILNDADITAALAACKAEGSF ( precursor fragment 4-25);

Sequence cross-coverage with epitope 88%;

Fragment may be released by calpain EC 3.4.22.17;

Potential marker of the allergen Gad c 1 and Gadus callarias proteins.

Reference:
Dziuba M., Minkiewicz P., Dąbek M., 2013, Peptides, products of specific proteolysis as molecular markers of allergenic proteins – in silico studies.

Acta Sci. Pol., Technol. Aliment. 12(1): 89-100.

202020192017-20182013-20142011-2012Book Chapters

2016

Abdullah, S. U., Y. Alexeev, P. E. Johnson, N. M. Rigby, A. R. Mackie, B. Dhaliwal, E. N. C. Mills. 2016. Ligand building to an allergenic lipid transfer protein enhances conformational flexibility resulting in an increase in susceptability to gastroduodenal proteolysis.

Nature Sci. Rep. 6: 30279.

Apostolovic, D., D. Stanic-Vucinic, H. de Jongh, G.

What is codfish allergy

de Jong, J. Mihailovic, J. Radosavljevic, M. Radibratovic, J. Nordlee, J. Baumert, M. Milcic, S. Taylor, N. Garrido Clua, T. Cirkovic Velickovic, S. Koppelman. 2016. Conformational stability of digestion-resistant peptides of peanut conglutins reveals the molecular basis of their allergenicity. Nature Sci. Rep. 6: 29249.

Courtney, R. C., S. L. Taylor, J. L. Baumert. 2016. Evaluation of commercial milk-specific lateral flow devices. J. Food Prot. 79: 1767-1774. Supplementary Tables

Downs, M.

L., J. L. Baumert, S. L. Taylor, E. N. C. Mills. 2016. Mass spectrometric analysis of allergens in roasted walnuts. J. Proteomics 142: 62-69.

Downs, M. L., A. Simpson, A. Custovic, A. Semic-Jusufagic, J. Barta, M. Fernandez-Rivas, S. L. Taylor, J. L. Baumert, E. N. C. Mills. 2016. Insoluble and soluble roasted walnut proteins retain antibody reactivity. Food Chem. 194: 1013-1021.

Goodman, R. E., M. Ebisawa, F. Ferreira, H. Sampson, R. van Ree, S. Vieths, J. Baumert, B. Bohle, S. Lalithambika, J.

Wise, S. Taylor. 2016. AllergenOnline: a peer-reviewed, curated allergen database to assess novel food proteins for potential cross-reactivity. Mol. Nutr. Food Res. 60: 1183-1198.

Houben, G., P. Burney, C.-H. Chan, R. Crevel, A. Dubois, R. Faludi, R. Kleine Entink, A. Knulst, S. Taylor, S. Ronsmans. 2016. Prioritisation of allergenic foods with honor to public health relevance: Report from an ILSI Europe Food Allergy Task Force Expert Group. Food Chem. Tox. 89: 8-18.

Ivens, K. O., J. L. Baumert, S. L. Taylor. 2016. Commercial milk enzyme-linked immunosorbent assay (ELISA) kit reactivities to purified milk proteins and milk-derived ingredients.

J. Food Sci. 81: T1871-1888.

Johnson, P. E., R. L. Sayers, L. A. Gethings, A. Balasundaram, J. T.

What is codfish allergy

Marsh, J. I. Langridge, E. N. C. Mills. 2016. Quantitative proteomic profiling of peanut allergens in food ingredients used for oral food challenges. Anal. Chem. 88: 5689-5695.

Koppelman, S. J., S. Jayasena, D. Luykx, E. Schepens, D. Apostolovic, G. de Jong, T. Isleib, J. Nordlee, J. Baumert, S. Taylor, H. Cheng, S. Maleki. 2016. Allergenicity attributes of diverse peanut market types. Food Chem. Tox. 91: 82-90.

Marchisotto, M. J., L. Harada, J. Blumenstock, L. Bilaver, S. Waserman, S. Sicherer, Y. Boloh, L.

Regent, M. Said, S. Schnadt, K. Allen, A. Muraro, S. Taylor, R. Gupta. 2016. Global perceptions of food allergy thresholds in 16 countries. Allergy 71: 1081-1085.

Sayers, R. L., P. E. Johnson, J. T. Marsh, P. Barran, H. Brown, E. N. C. Mills. 2016. The effect of thermal processing on the behaviour of peanut allergen peptide targets used in multiple reaction monitoring mass spectrometry experiments. Analyst 141: 4130-4141.

Schocker, F., J. L. Baumert, S. Kull, A. Petersen, W-M. Becker, U. Jappe. 2016. Prospective investigation on the transfer of Ara h 2, the most potent peanut allergen, in human breast milk. Ped. Allergy Immunol. 27: 348-355.

Turner, P. J., J. L. Baumert, K.

Beyer, R. J. Boyle, C. H. Chan, A. T. Clark, R. W. R. Crevel, A. Dunn-Galvin, M. Fernandez-Rivas, M. H. Gowland, L. Grabenhenrich, S. Hardy, G. Houben, J. Hourihane, A. Muraro, L. K. Poulsen, K. Pyrz, B. C. Remington, S. Schnadt, R. van Ree, C. Venter, M. Worm, E. N. C. Mills, G. Roberts, B. K. Ballmer-Weber. 2016. Can we identify patients at risk of life-threatening allergic reactions to food? Allergy 71: 1241-1255.

van der Valk, P. M. R. Gerth van Wijk, J. L. Baumert, J. A. Nordlee, B. J. Vlieg-Boerstra, H. de Groot, A. E. J. Dubois, N. W. de Jong. 2016. Threshold dose distribution and eliciting dose of cashew nut allergy. Ann. Allergy, Asthma Immunol.

117: 712-714.

2015

Dano, D., B. C. Remington, C. Astier, J. L. Baumert, A. G. Kruizinga, B. E. Bihain, S. L. Taylor, G. Kanny. 2015. Sesame allergy threshold dose distribution. Food Chem. Tox. 83: 48-53.

De Jongh, H. H., M. de Los Reyes Jimenez, J. L. Baumert, S. L. Taylor, S. J. Koppelman. 2015. Electrophoretic behavior in relation to the structural integrity of codfish parvalbumin upon heat treatment. J. Agric. Food Chem. 63: 4683-4689.

Duar, R. M., K. J. Clark, P. B. Patil, C. Hernandez, S. Bruning, T. E. Burkey, N. Madayiputhiya, S. L. Taylor, J. Walter. 2015. Identification and characterization of intestinal lactobacilli strains capable of degrading immunotoxic peptides present in gluten.

J. Applied Micro. 118: 515-527.

Dunn Galvin A., C. H. Chan, R. Crevel, K. Grimshaw, R. Poms, S. Schadt, S. L. Taylor, P. Turner, K. J. Allen, M. Austin, A. Baka, J. L. Baumert, S. Baumgartner, K. Beyer, L. Bucchini, M. Fernandez-Rivas, K. Grinter, G. Houben, J. Hourihane, F. Kenna, A. G. Kruizinga, G. Lack, C. B. Madsen, E. N. C. Mills, N. G. Papadopoulos, A. Alldick, L. Regent, R. Sherlock, J. M. Wal, G. Roberts. 2015. Precautionary allergen labelling: perspectives from key stakeholder groups. Allergy 70: 1039-1051.

Jayasena, S., M. Smits, D. Fiechter, A. de Jong, J. Nordlee, J.

Baumert, S. L. Taylor, R. H. Peters, S. J. Koppelman. 2015. Comparison of six commercial ELISA kits for their specificity and sensitivity in detecting diverse major peanut allergens. J. Agric. Food Chem. 63: 1849-1855.

Koppelman, S. J., G. Solymez, L. Niemann, F. E. Gaskin, S. L. Hefle, J. L. Baumert, S. L. Taylor. 2015. Sandwich enzyme-linked immunosorbent assay for detecting sesame seed in foods. BioMed Res. Intl. 10 pp, Retrieved from https://dx.doi.org/10.1155/2015/853836

Remington, B.

C., J. L. Baumert, W. M. Blom, G. F. Houben, S. L. Taylor, Kruizinga, A. G. 2015. Unintended allergens in precautionary labelled and unlabelled products pose significant risks to UK allergic consumers. 2015. Allergy 70: 813-819.

Taylor, S. L. and J. L. Baumert. 2015. Worldwide food allergy labeling and detection of allergens in processed foods. Chem. Immunol. Allergy 101: 227-234.

Taylor, S. L., G. F. Houben, J. L. Baumert, R. W. R. Crevel, K. J. Allen, A. E. J. Dubois, A. C. Knulst, B. C. Remington, A. G. Kruizinga, W. M. Blom. 2015. Understanding food allergen thresholds requires careful analysis of the available clinical data.

J. Allergy Clin. Immunol. 135: 583-584.

Urban, J. D., M. C. Carakostas, S. L.

What is codfish allergy

Taylor. 2015. Steviol glycoside safety: are highly purified steviol glycoside sweeteners food allergens? Food Chem. Tox. 75C: 71-78.

Verhoeckx, K. C. M., Y. M. Vissers, J. L. Baumert, R. Faludi, M. Feys, S. Flanagan, C. Herouet-Guicheney, T. Holzhauser, R. Shimojo, N. van der Bolt, H. Wichers, I. Kimber. 2015. Food processing and allergenicity. Food Chem. Tox. 80: 223-240.

Versluis, A., A.

C. Knulst, A.

What is codfish allergy

G. Kruizinga, A. Michelsen, G. F.

What is codfish allergy

Houben, J. L. Baumert, H. van Os-Medendorp. 2015. Frequency, severity and causes of unexpected allergic reactions to food: a systematic literature review. Clin. Exp. Allergy 45: 347-367.

Updated 19 November, 2019

To prevent a reaction, it is extremely significant to avoid every fish and fish products. Always read food labels and enquire questions about ingredients before eating a food that you own not prepared yourself.

Steer clear of seafood restaurants, where there is a high risk of food cross-contact.

You should also avoid touching fish and going to fish markets. Being in any area where fish are being cooked can put you at risk, as fish protein could be in the steam.

More than half of people who are allergic to one type of fish are also allergic to other fish. Your allergist will generally recommend you avoid every fish. If you are allergic to a specific type of fish but desire to eat other fish, talk to your doctor about further allergy testing.

Fish is one of the eight major allergens that must be listed on packaged foods sold in the U.S., as required by federal law.

Read more about food labels

There are more than 20,000 species of fish. Although this is not a finish list, allergic reactions own been commonly reported to:

  1. Scrod
  2. Hake
  3. Trout
  4. Sole
  5. Cod
  6. Herring
  7. Swordfish
  8. Mahi mahi
  9. Halibut
  10. Haddock
  11. Perch
  12. Snapper
  13. Pollock
  14. Anchovies
  15. Grouper
  16. Flounder
  17. Pike
  18. Bass
  19. Catfish
  20. Tilapia
  21. Salmon
  22. Tuna

Also avoid these fish products:

  1. Fish oil
  2. Fish gelatin, made from the skin and bones of fish
  3. Fish sticks (some people make the error of thinking these don’t contain genuine fish)

Some Unexpected Sources of Fish

  1. Imitation or artificial fish or shellfish (e.g., surimi, also known as “sea legs” or “sea sticks”)
  2. Bouillabaisse
  3. Worcestershire sauce
  4. Caponata, a Sicilian eggplant relish
  5. Barbecue sauce
  6. Caesar salad and Caesar dressing
  7. Certain cuisines (especially African, Chinese, Indonesian, Thai and Vietnamese)—even if you order a fish-free dish, there is high risk of cross-contact

Allergens are not always present in these food and products, but fish can appear in surprising places.

Again, read food labels and enquire questions if you’re ever unsure about an item’s ingredients.

Awards 2013-2019

2015

Winfrid Pickl (left) and Rudolf Vanlenta (right), members of the local organizing committee, with some of the award winners at the ÖGAI Symposium 2015.

Barbara Gepp received a poster award at the symposium 50 Years of B Lymphocytes of the Austrian Society for Allergology and Immunology in Vienna for her presentation:

Gepp B, Lengger N, Kitzmüller C, Radauer C, Bohle B, Breiteneder H:
A chimeric protein containing the C-terminus of Bet v 1 is a potent inducer of basophil degranulation.
Poster presentation at the ÖGAI Symposium: 50 Years of B Lymphocytes, December 11-12, 2015, Vienna, Austria

At the International Symposium of Molecular Allergology which took plaxe from November 19th to 21st in Lisbon, Portugal, several members of our division received avards for their presentations:

Paweł Dubiela received a poster award for his presentation

Dubiela P, Humeniuk P, Pfeifer S, Bublin M, Borowski T, Hoffmann-Sommergruber K:
Specificity of non-specific lipid transfer proteins and influence of the ligands on their three-dimensional structure.
Poster presentation at the International Symposium on Molecular Allergology, November 19-21, 2015, Lisbon, Portugal.

Barbara Gepp received a travel grant for her presentation

Gepp B, Lengger N, Möbs C, Pfützner W, Radauer C, Bohle B, Breiteneder H:
Longitudial analysis of Bet v 1-specific epitope repertoires during birch pollen immunotherpay.
Oral presentation at the International Symposium on Molecular Allergology, November 19-21, 2015, Lisbon, Portugal.

Angelika Tscheppe received a travel grant for her presentation

Tscheppe A, Palmberger D, Bublin M, Radauer C, Palladino C, Gepp B, Lengger N, Grabherr R, Breiteneder H:
Production of a recombinant hypoallergenic variant of the major peanut allergen Ara h 2 for allergen-specific immunotherapy.
Poster presentation at the International Symposium on Molecular Allergology, November 19-21, 2015, Lisbon, Portugal.

Award winners from the Depatment of Pathophysiology and Allergy Research at the EAACI Congress 2015: Judit Fazekas, Nora Zulehner, Lukas Einhorn, Stefanie Wagner, and Barbara Gepp

At the 2015 EAACI Annual Congress in Barcelona, Barbara Gepp received a Best Oral Presentation Award for her presentation:

Gepp B, Lengger N, Kitzmüller C, Radauer C, Bohle B, Breiteneder H:
Basophil activation tests reveal that the C-terminus of Bet v 1 contains significant IgE binding epitopes.
Oral Presentation at the EAACI Annual Congress, une 6-10, 2015, Barcelona, Spain.

[top]

2018

At the 6th SFB F46 work in progress meeting in Ottenstein, Lower Austria, Piotr Humeniuk and Öykü Üzülmez were awarded for their poster presentations:

Humeniuk P, Geiselhart S, Battin C, Webb T, Steinberger P, Paster W, Hoffmann-Sommergruber K:
A Jurkat based NF?B-eGFP iNKT reporter cell line to assess the interaction of food-derived lipids with iNKT cell receptors.
Poster presentation at the 6th SFB F46 work in progress meeting, October 21�23, 2018, Ottenstein, Austria

Üzülmez O, Mayr V, Tscheppe A, Palladino C, Lengger N, Breiteneder H:
Critical evaluation of the expression of major allergens Bet v 1 and Ara h 2 in Nicotiana benthamiana.
Poster presentation at the 6th SFB F46 work in progress meeting, October 21-23, 2018, Ottenstein, Austria

At the 9th Retreat of the Middle for Pathophysiology, Infectiology and Immunology, Piotr Humeniuk and Angelika Tscheppe were awarded for their poster presentations:

Humeniuk P, Geiselhart S, Battin C, Webb T, Steinberger P, Paster W, Hoffmann-Sommergruber K:
A Jurkat based NF?B-eGFP iNKT reporter cell line to assess the interaction of food-derived lipids with iNKT cell receptors.
Poster presentation at the 9th Retreat of the Middle for Pathophysiology, Infectiology and Immunology, September 17, 2018, Vienna, Austria

Tscheppe A, Palmberger D, Radauer C, Van Rijt LS, Bublin M, Hafner C, Hemmer W, Mayr V, Palladino C, Logiantara A, van Ree R, Grabherr R, Breiteneder H:
Contribution of conformational and linear IgE epitopes to Ara h 2-specific IgE-binding — in vitro and in vivo studies.
Poster presentation at the 9th Retreat of the Middle for Pathophysiology, Infectiology and Immunology, September 17, 2018, Vienna, Austria

At the 14th YSA PhD Symposium of the Medical University of Vienna, Öykü Üzülmez received a poster award for her presentation

Üzülmez O, Mayr V, Tscheppe A, Palladino C, Breiteneder H:
Expression of Bet v 1 in Nicotiana benthamiana plants based on in-planta assembly of separate deconstructed TMV provector modules.
Poster presentation at the 14th YSA PhD Symposium, Medical University of Vienna, Austria, June 7-8, 2018.

At the Annual Meeting of the European Academy of Allergy and Clinical Immunology (EAACI), Angelika Tscheppe won a Junior Members Poster Award for her presentation:

Tscheppe A, Palmberger D, Radauer C, Van Rijt LS, Bublin M, Hafner C, Hemmer W, Mayr V, Palladino C, Logiantara A, van Ree R, Grabherr R, Breiteneder H:
Contribution of conformational and linear IgE epitopes to Ara h 2-specific IgE-binding — in vitro and in vivo studies.
Poster presentation at the 62nd EAACI congress, May 26-30, 2018, Munich, Germany

Pawel Dubiela received a poster award for his presentation at the EAACI Winter School on Basic Immunology Research in Allergy and Clinical Immunology

Dubiela P, Kabasser S, Smargiasso N, Geiselhart S, Bublin M, Hafner C, Mazzucchelli G, Hoffmann-Sommergruber K:
Jug r 6 but not Jug r 2 is the allergenic vicilin present in walnut kernels responsible for IgE cross-reactivities to other tree nuts and seeds.
Poster presentation at the 16th EAACI Immunology Winter School on Basic Immunology Research in Allergy and Clinical Immunology, January 25-28, 2018, Saas-Fee, Switzerland

[top]

2014

At the Annual Meeting of the Austrian Society for Allergology and Immunology, Paweł Dubiela received a poster award for his presentation:

Dubiela P, Pfeifer S, Bublin M, Hafner C, Hoffmann-Sommergruber K:
Cor a 8 displays reduced stability upon heat and digestion treatment.
Annual Meeting of the Austrian Socienty for Allergology and Immunology, Nov.

6-8, 2014, Salzburg, Austria

Paweł Dubiela received a travel grant for the 2014 EAACI Food Allergy and Anaphylaxis Meeting in Dublin, Ireland.

Dubiela P, Pfeifer D, Bublin M, Hafner C, Hoffmann-Sommergruber K:
The non-specific lipid transfer protein from hazelnut, Cor a 8, a relevant food allergen.
Poster presentation at the Food Allergy and Anaphylaxis Meeting, October 9-11, 2014, Dublin, Ireland
Clin.

Transl. Allergy 2015, 5 (suppl. 3), P17.

Barbara Gepp received a poster award at the Annual Congress of the European Academy of Allergy and Clinical Immunology for her presentation:

Gepp B, Ackerbauer D, Lengger N, Gruber F, Mildner M, Breiteneder H:
The major birch pollen allergen Bet v 1 binds lipids from birch and grass pollen but not from peanuts.
EAACI Congress, June 7-11, 2014, Copenhagen, Denmark. Allergy, 2014, 60 suppl. 99, 464.

[top]

2016

At the EAACI Food Allergy and Anaphylaxis Meeting in Rome, Italy, Paweł Dubiela received a poster award for his presentation:

Dubiela P, Humeniuk P, Pfeifer S, Bublin M, Cantini F, Borowski T, Alessandri S, Hoffmann-Sommergruber K:
Influence of binding of free fatty acids to nsLTP on their tertiary structure and allergenic activity.
Poster presentation at the EAACI Food Allergy and Anaphylaxis Meeting, October 13-15, 2016, Rome, Italy

Angelika Tscheppe received an EFIS-EJI travel grant for her presentation at the International Congress of Immunology in Melbourne, Australia:

Tscheppe A, Palmberger D, Bublin M, Radauer C, Palladino C, Gepp B, Lengger N, Grabherr R, Breiteneder H:
Production of a recombinant hypoallergenic variant of the major peanut allergen Ara h 2 for allergen-specific immunotherapy.
Oral presentation at the 16th International Congress of Immunology, August 21-26, 2016, Melbourne, Australia

Paweł Dubiela received a travel grant from the Students Association of the Medical University of Vienna for his presentation at the FASEB meeting IgE and Allergy, 50 Years & Onward:

Dubiela P, Offermann LR, Bublin M, Perdue MP, Pfeifer S, Borowski T, Chruszcz M, Hoffmann-Sommergruber K:
Structural and functional characterization of the hazelnut allergen Cor a 8.
Poster presentation at the FASEB meeting IgE and Allergy, 50 Years & Onward, July 24-29, 2016, West Palm Beach, FL, USA

Left: Tanja Kalic with her awarded poster; right: Paweł Dubiela with two other poster award winners from the Department of Pathophysiology and Allergen Research: Gabriela Sanchez-Acosta and Caterina Vizzardell.

At the EAACI Congress 2016, which took put from June 11 to 15, 2016 in Vienna, Paweł Dubiela and Tanja Kalic won poster awards for their presentations:

Dubiela P, Humeniuk P, Pfeifer S, Bublin M, Cantini F, Borowski T, Alessandri S, Hoffmann-Sommergruber K:
Specificity of non specific lipid transfer proteins and influence of the ligands on their three dimensional structure.
Poster presentation at the EAACI Congress 2016, June 11-15, 2016, Vienna, Austria

Kalic T, Ellinger I, Gepp B, Radauer C, Niederberger V, Waltl E, Breiteneder H:
The major cod allergen Gad m 1 and the codfish food matrix interact with bronchial epithelial cells and modulate expression of cytokines.
Poster presentation at the EAACI Congress 2016, June 11-15, 2016, Vienna, Austria

Angelika Tscheppe received a poster award at the 14th EAACI Immunology Winter School for her presentation:

Tscheppe A, Palmberger D, Bublin M, Radauer C, Palladino C, Gepp B, Lengger N, Grabherr R, Breiteneder H:
Production of a recombinant hypoallergenic variant of the major peanut allergen Ara h 2 in the baculovirus insect cell system.
Poster presenstation at the 14th EAACI Immunology Winter School, February 4-7, 2016, Pocol, Cortina d’Ampezzo, Italy

[top]

2019

At the Annual Congress of the European Academy of Allergy and Immunology in Lisbon, Portugal, Piotr Humeniuk, Tanja Kalic and Christoph Nagl received poster awards for their presentations:

Humeniuk P, Geiselhart S, Battin C, Webb T, Steinberger P, Paster W, Hoffmann-Sommergruber K:
A jurkat based NF?B-EGFP INKT reporter cell line to assess the interaction of food-derived lipids with INKT cell receptors.
Poster presentation at the EAACI Congress 2019, June 1-5, 1019, Lisbon, Portugal
Allergy 2019, 74 suppl.

106, 602. [Full Text]

Kalic T, Ellinger I, Kamath S, Palladino C, Mayr V, Ruethers T, Waltl E, Niederberger V, Radauer C, Hafner C, Lopata A, Bublin M, Breiteneder H:
Low molecular weight components from fish modify physical and immunological properties of the bronchial epithelium.
Poster discussion presentation at the EAACI Congress 2019, June 1-5, 2019, Lisbon, Portugal
Allergy 2019, 74 suppl. 106, 257-8. [Full Text]

Nagl C, Bublin M, Caimmi D, Demoly P, Hoffmann-Sommergruber K:
Peamaclein (Pru P 7): Recombinant expression, physicochemical characterization and its application for component resolved diagnosis.
Poster presentation at the EAACI Congress 2019, June 1-5, 1019, Lisbon, Portugal
Allergy 2019, 74 suppl.

106, 476. [Full Text]

AT the 17th EAACI Immunology Winter School "Basic Immunology Research in Allergy and Clinical Immunology", which took put January 24-27, 2019 in Trysil, Norway, Stefanie Schmalz won a poster award for her presentation:

Schmalz S, Radauer C:
Structure based epitope grafting of the major birch pollen allergen, Bet v 1, as tool for exploring conformational IgE epitopes.
Poster presentation at the 17th EAACI Immunology Winter School "Basic Immunology Research in Allergy and Clinical Immunology", January 24-27, 2019, Trysil, Norway

2017

At the annual meeting of the Austrian Society for Allergology and Immunology, Vanessa Mayr was granted a poter award for her presentation:

Mayr V, Bublin M, Nagl C, Breiteneder H:
Establishment of a new expression platform for plant allergens.
Poster presentation at the ÖGAI Annual Meeting, November 23-25, Vienna, Austria

Tanka Kalic was granted a poster award at the work in progress meeting of the Special Research Programm SFB-F46 Towards prevention and therapy of allergy for her presentation:

Kalic T, Ruethers T, Radauer C, Taki A, Linhart B, Swoboda I, Morel F, Hilger C, Hoffmann-Sommergruber K, Hafner C, Lopata A, Morisset M, Kuehn A, Breiteneder H:
Investigation of clinical and immunological reactivities of the major fish allergens parvalbumins.
Poster presentation at the 5th SFB F46 work in progress meeting, November 5-7, 2017, Ottenstein, Austria

Piotr Humeniuk reveived a travel grant from the Austrian Society for Allergology and Immuology for his presentation:

Humeniuk P, Paster W, Geiselhart S, Webb T, Steinberger P, Hoffmann-Sommergruber K:
A Jurkat based NFkB-EGFP iNKT reporter cell line to assess the interaction of food-derived lipids with iNKT cells receptors.
Poster presentation at the 10th International CD1-MR1 Workshop, November 3-7, 2017, Napa, CA, USA

At the 3rd Conference of the ImpARAS COST Action in Helsingor, Denmark, Tanja Kalic received a presentation award for her talk:

Kalic T, Ruethers T, Radauer C, Taki A, Linhart B, Swoboda I, Morel F, Hilger C, Hoffmann-Sommergruber K, Hafner C, Lopata A, Morisset M, Kuehn A, Breiteneder H:
Investigation of clinical and immunological reactivities of the major fish allergens parvalbumins.
Oral flash presentation at the 3rd ImpARAS Conference, October 10-12, 2017, Helsingor, Denmark

Pawel Dubiela received a travel grant from the Federation of Clinical Immunology Societies (FOCIS) to attend the FOCIS European Advanced Course in Basic and Clinical Immunology, October 16-18, 2017, Prague, Czech Republic.

Pawel Dubiela was granted a Scientific & Technological Cooperation scholarship from the OeAD to do a scientific internship at the University of Belgrade in September 2017.

At the annual meeting of the European Academy of Allergy and Clinical Immunology (EAACI), two PhD students from the Division of Medical Biotechnology gave award winning presentations. Pawel Dubiela received travel grants from the Austrian Society for Allergology and Immunology (ÖGAI) and the Students’ Union of the Medical University of Vienna, Chiara Palladino received a travel grant from the ÖGAI and a poster award from the EAACI.

The awarded presentations were:

Dubiela P, Kabasser S, Geiselhart S, Bublin M, Mazzucchelli G, Hoffmann-Sommergruber K:
Purification and characterization of a novel allergenic walnut vicilin-like protein.
Poster presentation at the Annual Meeting of the European Academy of Allergy and Clinical Immunology, June 17-21, 2017, Helsinki, Finnland

Palladino C, Kalic T, Ellinger I, Waltl E, Mayr V, Niederberger V, Palomares O, Breiteneder H:
Peanut allergens Ara h 1 and Ara h 2 and peanut lipids impact on barrier function of human airways epithelial cells.
Poster presentation at the Annual Meeting of the European Academy of Allergy and Clinical Immunology, June 17-21, 2017, Helsinki, Finnland

At the PhD symposium of the Young Scientists Association (YSA) of the Medical University of Vienna, Pawel Dubiela received a poster award for his presentation:

Dubiela P, Aina R, Humeniuk P, Geiselhart S, Bublin M, Polak D, Cantini F, Borowski T, Bohle B, Alessandri S, Hoffmann-Sommergruber K:
Impact of free fatty acids binding on the tertiary structure and allergenic activity of the major peach allergen Pru p 3.
Poster presentation at the 13th YSA PhD Symposium, June 8-9, 2017, Medical University of Vienna, Austria

Angelika Tscheppe was granted a Short Term Scientific Mission scholarship by the ImpARAS COST Action for a research stay at the Department of Experimental Immunology, Academic Medical Middle, University of Amsterdam, The Netherlands from June to September 2017.

Chiara Palladino received a travel grant from the European Federation of Immunological Societies (EFIS) for her presentation:

Palladino C, Kalic T, Ellinger I, Waltl E, Niederberger V, Palomares O, Breiteneder H:
Peanut major allergens and peanut lipids impact on barrier function of human airways epithelial cells.
Poster presentation at the 12th ENII EFIS EJI Summer School on Advanced Immunology, May 6-13, 2017, Porto Cervo, Sardinia, Italy

Angelika Tscheppe was awarded a travel grant by the Austrian Society for Allergology and Immunology for her presentation:

Tscheppe A, Palmberger D, Radauer C, Bublin M, Hafner C, Hemmer W, Mayr V, Palladino C, Gepp B, Lengger N, Grabherr R, Breiteneder H:
Influence of conformational and linear IgE epitopes on Ara h 2-specific IgE binding.
Poster presentation at the Annual Meeting of the American Academy of Allergy, Asthma & Immunology (AAAAI) March 3-6, 2017, Atlanta, GA, USA

[top]

2013

Daniela Pucchiarelli received a travel grant from the European Federation of Immunological Societies for for her presentation at the 2nd Meeting of the Middle European Societies for Immunology and Allergology in Opatija, Kroatia:

Pucchiarelli D, Csaderova L, Juliano F, Lengger N, Breiteneder H, Pastorekova S, Hafner C:
Hypoxia influences the response to vemurafenib in V600E mutated melanoma cells.
2nd Meeting of the Middle-European Societies for Immunology and Allergology, October 10-13, 2013, Opatija, Croatia

[top]


RELATED VIDEO: